PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.G406S
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB_related
Protein Properties Length: 117aa    MW: 13685.5 Da    PI: 9.9552
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.G406SgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.53e-181663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++l+++++ +G g W++ a+  g++Rt+k+c++rw++yl
      Aradu.G406S 16 KGPWTVEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLNYL 63
                     79*********************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.1E-24966IPR009057Homeodomain-like
PROSITE profilePS5129424.21167IPR017930Myb domain
SuperFamilySSF466895.82E-221399IPR009057Homeodomain-like
SMARTSM007172.8E-141565IPR001005SANT/Myb domain
PfamPF002494.0E-171663IPR001005SANT/Myb domain
CDDcd001671.39E-101863No hitNo description
PROSITE profilePS500904.61264100IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.4E-76789IPR009057Homeodomain-like
SMARTSM007179.568105IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 117 aa     Download sequence    Send to blast
MDKKPCNSSQ DPEVRKGPWT VEEDLILINY IANHGEGVWN SLAKAAGLKR TGKSCRLRWL  60
NYLRPDVRRG NITPEEQLLI MELHAKWGNS TDNEIKNFWR TRIQKHIKQA ENFQSQQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-171110722128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankY111057e-85Y11105.1 P.sativum mRNA for Myb-like protein (Myb26).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015966287.11e-80PREDICTED: myb-related protein 305-like
SwissprotP813916e-69MYB05_ANTMA; Myb-related protein 305
TrEMBLA0A151QWW36e-75A0A151QWW3_CAJCA; Myb-related protein 305 family
STRINGGLYMA16G07960.12e-72(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33053469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27810.13e-64myb domain protein 21